VSIG8 蛋白, Mouse (HEK293, C-His)

VSIG8 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived VSIG8 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VSIG8 Protein, Mouse (HEK293, C-His) is 241 a.a., with molecular weight of ~27 kDa.

Measured by its ability to chemoattract Jurkat human T-lymphocyte leukemia cells. The ED₅₀ this effect is 0.7887 μg/ml, corresponding to a specific activity is 1267.91 units/mg.

• 
  Measured by its ability to chemoattract Jurkat human T-lymphocyte leukemia cells. The ED₅₀ this effect is 0.7887 μg/mL, corresponding to a specific activity is 1267.91 units/mg.

Mouse

HEK293

C-6*His

Q6P3A4-1 (V22-G262)

240916  [NCBI]

VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVG

Approximately 27 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

无菌粉末.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.