Agouti-related Protein (AGRP) (83-132) Amide (human) (TFA) 

Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake^[1][2].

Melanocortin-4 receptor^[2]

Agouti-related Protein (AGRP) (83-132) increases food intake and decreases spontaneous locomotor activity in rats^[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

5790.62 (free acid)

C₂₃₅H₃₆₂N₇₆O₆₇S₁₁._xC₂HF₃O₂

固体

White to off-white

Ser-Ser-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-NH2 (Disulfide bridge: Cys1-Cys4; Cys2-Cys6; Cys3-Cys9; Cys5-Cys10; Cys7-Cys8)

SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (Disulfide bridge: Cys1-Cys4; Cys2-Cys6; Cys3-Cys9; Cys5-Cys10; Cys7-Cys8)

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture and light, under nitrogen

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

• [1]. Donald W. Pfaff, et al. Chapter 1 - Hormones Can Facilitate or Suppress Behaviors. Principles of Hormone/Behavior Relations (Second Edition). Academic Press, 2018, Pages 3-26, ISBN 9780128113714.

  [2]. Tang-Christensen M, et al. Central administration of ghrelin and agouti-related protein (83-132) increases food intake and decreases spontaneous locomotor activity in rats. Endocrinology. 2004 Oct;145(10):4645-52.  [Content Brief]