Preptin (rat) 

Preptin, an osteogenic peptide product of the pancreatic beta-cell, corresponds to Asp⁶⁹-Leu¹⁰² of pro-IGF-II^[1].

Preptin dose-dependently stimulates the proliferation (cell numberand DNA synthesis) of primary fetal rat osteoblasts and osteoblast-likecell lines at periphysiological concentrations (10^-11M)^[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

3932.36

C₁₈₁H₂₆₈N₄₈O₅₁

315197-73-0

Asp-Val-Ser-Thr-Ser-Gln-Ala-Val-Leu-Pro-Asp-Asp-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Lys-Phe-Asp-Thr-Trp-Arg-Gln-Ser-Ala-Gly-Arg-Leu

DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. J Cornish, et al. Preptin, another peptide product of the pancreatic beta-cell, is osteogenic in vitro and in vivo. Am J Physiol Endocrinol Metab. 2007 Jan;292(1):E117-22.  [Content Brief]