Animal-Free IFN-lambda 2/IL-28A 蛋白, Mouse (His)

Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His) is 174 a.a., with molecular weight of ~20.61 kDa.

Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <2 ng/mL.

Mouse

E. coli

C-His

AAX58714.1 (D20-V193)

330496  [NCBI]

MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV

Approximately 20.61 kDa

Greater than 95% as determined by reducing SDS-PAGE.

无菌粉末

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.