Epigen 蛋白, Human（E. coli）

Epigen Protein, Human（E. coli） is the recombinant human-derived Epigen, expressed by E. coli , with tag Free labeled tag. The total length of Epigen Protein, Human（E. coli） is 81 a.a.,

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 116.1 ng/mL, corresponding to a specific activity is 8.61×10³ units/mg.

• 
  Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 116.1 ng/mL, corresponding to a specific activity is 8.61×10³ units/mg.

Human

E. coli

Tag Free

Q6UW88-1 (A24-A104)

255324

AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA

Approximately 9 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

无菌粉末

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.