GITR 蛋白, Cynomolgus (HEK293, Fc)

GITR Protein, Cynomolgus (HEK293, Fc) is the recombinant Rhesus Macaque-derived GITR protein, expressed by HEK293 , with C-hFc labeled tag.

Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque GITR at 5 μg/mL (100 μL/well) can bind Biotinylated GITR Ligand. The ED₅₀ for this effect is 0.9219 μg/mL, corresponding to a specific activity is 1.08×10^3 Unit/mg.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque GITR at 5 μg/mL (100 μL/well) can bind Biotinylated GITR Ligand. The ED₅₀ for this effect is 0.9219 μg/mL, corresponding to a specific activity is 1.08×10³ Unit/mg.

Rhesus Macaque

HEK293

C-hFc

XP_005545180.2 (Q20-E155)

102146362

QRPTGGPGCGPGRLLLGTGKDARCCRVHPTRCCRDYQSEECCSEWDCVCVQPEFHCGNPCCTTCQHHPCPSGQGVQPQGKFSFGFRCVDCALGTFSRGHDGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE

Approximately 48 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

无菌粉末.

Lyophilized from sterile 20 mM Tris-HCL, 150 mM NaCL, 100 mM arginine, 150 mM Glycine, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.