Animal-Free IL-3 蛋白, Human (His)

Animal-Free IL-3 Protein, Human (His) is the recombinant human-derived animal-FreeIL-3 protein, expressed by E. coli , with C-His labeled tag. , has molecular weight of ~16 kDa.

Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <0.15 ng/mL. The specific activity of recombinant human IL-3 is approximately >1.2 x 10⁶ IU/mg

Human

E. coli

C-His

AAC08706.1 (A20-F152)

3562

MAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Approximately 16 kDa

Greater than 95% as determined by reducing SDS-PAGE.

无菌粉末.

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.