CTRB1 蛋白, Rat (HEK293, His)

CTRB1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTRB1 protein, expressed by HEK293 , with C-His labeled tag. The total length of CTRB1 Protein, Rat (HEK293, His) is 263 a.a., with molecular weight of ~27.4 KDa.

Measured by its ability to cleave a peptide substrate, Suc-AAPF-pNA. Read at OD 410 nm. The specific activity is 969.68 pmol/min/mg, as measured under the described conditions.

Rat

HEK293

C-His

P07338 (C19-N263)

24291  [NCBI]

CGVPTIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVCLPNVDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCSTSTPAVYSRVTALMPWVQQILEAN

Approximately 27 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

无菌粉末

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.