GPX4 蛋白, Human (HEK293, Flag)

GXP4 activity is measured indirectly. GXP4 converts reduced glutathione (GSH) to oxidized glutathione (GSSG) by reducing hydroperoxide (ROOH). GSSG is then converted back to its reduced form by glutathione reductase (GR) in the presence of NAPDH, which is converted into NADP+. NADPH is intrinsically fluorescent, a property lost upon oxidation to NADP+. The fluorescence signal is inversely proportional to the enzyme concentration. This is because with high GPX4 concentrations, you have more NADPH (fluorescent molecule) converting to NADP+.

Human

HEK293

N-Flag

P36969-1 : C29-F197(U73C)

2879

CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Approximately 21 kDa

Greater than 90% as determined by reducing SDS-PAGE.

溶液.

Supplied as a 0.22 μm filtered solution of 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 20% glycerol, and 100 µg/ml FLAG peptide.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.