Albiglutide fragment TFA  (Synonyms: GLP-1-Gly8 TFA; GLP-1 (7-36) analog TFA)

Albiglutide fragment (GLP-1 (7-36) analog) TFA is an active fragment of Albiglutide (7-36) and a glucagon-like peptide-1 (GLP-1) analog (a long-acting GLP-1 receptor agonist). Albiglutide is produced by the fusion of DPP-4 resistant GLP-1 dimer with the human albumin gene. Moreover, Albiglutide fragment TFA significantly reduces glycosylated hemoglobin (A1C) and is used in type 2 diabetes (T2D) studies^[1][2][3][4].

3283.60 (free base)

C₁₄₈H₂₂₄N₄₀O₄₅.xC₂HF₃O₂

固体

White to light yellow

His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture and light, under nitrogen

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

• [1]. Matthews JE, et al. Pharmacodynamics, pharmacokinetics, safety, and tolerability of albiglutide, a long-acting glucagon-like peptide-1 mimetic, in patients with type 2 diabetes. J Clin Endocrinol Metab. 2008 Dec;93(12):4810-7.  [Content Brief]

  [2]. Blair HA, et al. Albiglutide: a review of its use in patients with type 2 diabetes mellitus. Drugs. 2015 Apr;75(6):651-63.  [Content Brief]

  [3]. Trujillo JM, et al. Albiglutide: a new GLP-1 receptor agonist for the treatment of type 2 diabetes. Ann Pharmacother. 2014 Nov;48(11):1494-501.  [Content Brief]

  [4]. Doyle ME, et al. Insertion of an N-terminal 6-aminohexanoic acid after the 7 amino acid position of glucagon-like peptide-1 produces a long-acting hypoglycemic agent. Endocrinology. 2001 Oct;142(10):4462-8.  [Content Brief]