[DPro5] Corticotropin Releasing Factor, human, rat 

[DPro5] Corticotropin Releasing Factor, human, rat is a selective R2 agonist of corticotropin releasing factor/hormone. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin. [DPro5] Corticotropin Releasing Factor, human, rat fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat^[1].

[DPro5] Corticotropin Releasing Factor, human, rat (1 nM; 1 h) diminishes the amplitude of hippocampal population spike and prevents the onset of long-term potentiation (LTP)^[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

[DPro5] Corticotropin Releasing Factor, human, rat (0.01-1 μg; i.c.v.; single dose) doesn’t induce the typical anxiogenic effect, but produces a nonspecific suppression of behavior in Sprague-Dowley rats. And [DPro5] Corticotropin Releasing Factor, human, rat also enhances the short-term memory to a maximum degree and prevented the memory loss induced by diazepam^[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

4757.45

C₂₀₈H₃₄₄N₆₀O₆₃S₂

195628-97-8

SEEP-{d-Pro}-ISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Shabanov PD, et al. [Anxiogenic and mnestic effects of corticoliberin and its analogs introduced into the brain ventriculi of rats]. Eksp Klin Farmakol. 2006 Nov-Dec;69(6):3-8. Russian.  [Content Brief]

  [2]. Rebaudo R, et al. Electrophysiological effects of sustained delivery of CRF and its receptor agonists in hippocampal slices. Brain Res. 2001 Dec 13;922(1):112-7.  [Content Brief]