Neuropeptide Y (human) free acid 

Neuropeptide Y (human) free acid is the deamidated form of Neuropeptide Y (human, rat, mouse) (HY-P0198). The amidation of Neuropeptide Y C-terminal tyrosine is critical for its function. Non-amidated Neuropeptide Y fails to elicit G protein signaling^[1][2][4].

4272.67

C₁₈₉H₂₈₄N₅₄O₅₈S

99575-89-0

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQ

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Cajado et al. Neuropeptide Y family-degrading metallopeptidases in the Tityus serrulatus venom partially blocked by commercial antivenoms. Toxicol Sci. 2014 Dec;142(2):418-26.  [Content Brief]

  [2]. Sung CP, et al. Neuropeptide Y upregulates the adhesiveness of human endothelial cells for leukocytes. Circ Res. 1991 Jan;68(1):314-8.  [Content Brief]

  [3]. Gordon EA, et al. Characterization of functional neuropeptide Y receptors in a human neuroblastoma cell line. J Neurochem. 1990 Aug;55(2):506-13.  [Content Brief]

  [4]. Chaehee Park, et al. Structural basis of neuropeptide Y signaling through Y1 receptor. Nat Commun. 2022 Feb 14;13(1):853.  [Content Brief]