β-Amyloid-¹⁵N (1-40) TFA  (Synonyms: Amyloid Beta-Peptide-¹⁵N (1-40) (human) TFA; Amyloid β-Peptide-¹⁵N (1-40) (human) TFA)

β-Amyloid-¹⁵N (1-40) (TFA) is the ¹⁵N-labledβ-Amyloid (1-40) (TFA). β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease[1].

Stable heavy isotopes of hydrogen, carbon, and other elements have been incorporated into drug molecules, largely as tracers for quantitation during the drug development process. Deuteration has gained attention because of its potential to affect the pharmacokinetic and metabolic profiles of drugs^[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

4330.86 (free acid)

C₁₉₄H₂₉₅N₅₂¹⁵NO₅₈S.xC₂HF₃O₂

Asp-Ala-{Glu-15N}-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val (TFA)

DA-{Glu-15N}-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (TFA)

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Shoji M, et al. Cerebrospinal fluid Abeta40 and Abeta42: natural course and clinical usefulness. Front Biosci. 2002 Apr 1;7:d997-1006.  [Content Brief]

  [2]. Russak EM, et al. Impact of Deuterium Substitution on the Pharmacokinetics of Pharmaceuticals. Ann Pharmacother. 2019;53(2):211-216.  [Content Brief]