MICA 蛋白, Cynomolgus (HEK293, His)

MICA Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MICA, expressed by HEK293 , with C-His labeled tag. ,

Immobilized Human NKG2D Protein at 5 μg/mL (100 μL/well) can bind Cynomolgus MICA Protein. The ED₅₀ for this effect is 0.3073 μg/mL.

• 
  Immobilized Human NKG2D Protein at 5 μg/mL (100 μL/well) can bind Cynomolgus MICA Protein . The ED₅₀ for this effect is 0.3073 μg/mL.

Cynomolgus

HEK293

C-His

AAO24115 (E1-P288)

123572792  [NCBI]

ELHSLRYNVTVLSRDGSVQSEFLAEGHLDGQLFVRYDRETRRARPQGQWAEDVLGAKTWDTETGDLTENGKDLRMTLAHIKGQKGGLHSLQEIKVCEIHEDNSTGGLRHFYYDGELFLSQNLETQEWTELQSSRAQTLALNIRNFWKEDTMKTKTHYRAVQADCLKKLQRYLESGVAVRRTAPPMVNVTHSEASEGNITVTCRASGFYPRNIALTWRQDGVSLNHNAQQWGGILPDQNGTYQTWVATRIRQGEEQRFACYMEHSGNHSTHPVPSGKVLVFQSQWLDIP

Approximately 40-55 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

无菌粉末

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.