CRF, bovine TFA  (Synonyms: Corticotropin Releasing Factor bovine TFA)

CRF, bovine (TFA) is a potent agonist of CRF receptor, and displaces [¹²⁵I-Tyr]ovine CRF with a K_i of 3.52 nM^[1].

Ki: 3.52 nM (CRF receptor)^[1].

CRF, bovine is a potent agonist of CRF receptor, and displaces [¹²⁵I-Tyr]ovine CRF with a K_i of 3.52 nM^[1]. CRF shows pEC₅₀s of 11.16, 8.53 and 8.70 for human CRF₁, human CRF₂ and rat CRF_2α^[2]. CRF is released from hypothalamic-pituitary-adrenal (HPA) axis induced by stress, and leads to production of glucocorticoids which down regulate immune responses. CRF also has proinflammatory effects. CRF affects brain microvessel endothelial cells (BMEC) structure or function, CRF (100 nM) significantly increases cAMP in BMEC^[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

4697.34 (free base)

C₂₀₆H₃₄₀N₆₀O₆₃S.xC₂HF₃O₂

固体

White to off-white

Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

• [1]. CRF, bovine is a potent agonist of CRF receptor, and displaces [¹²⁵I-Tyr]ovine CRF with a K_i of 3.52 nM^[1]. CRF shows pEC₅₀s of 11.16, 8.53 and 8.70 for human CRF₁, human CRF₂ and rat CRF_2α^[2]. CRF is released from hypothalamic-pituitary-adrenal (HPA) axis induced by stress, and leads to production of glucocorticoids which down regulate immune responses. CRF also has proinflammatory effects. CRF affects brain microvessel endothelial cells (BMEC) structure or function, CRF (100 nM) significantly increases cAMP in BMEC^[3].  [Content Brief]

  [2]. Smart D, et al. Characterisation using microphysiometry of CRF receptor pharmacology. Eur J Pharmacol. 1999 Aug 27;379(2-3):229-35.  [Content Brief]

  [3]. Esposito P, et al. Corticotropin-releasing factor (CRF) can directly affect brain microvessel endothelial cells. Brain Res. 2003 Apr 11;968(2):192-8.  [Content Brief]